Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 112682..113207 | Replicon | plasmid pMS1718-1 |
Accession | NZ_CP097717 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | M9O77_RS25020 | Protein ID | WP_001159868.1 |
Coordinates | 112902..113207 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | M9O77_RS25015 | Protein ID | WP_000813634.1 |
Coordinates | 112682..112900 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS24985 (108074) | 108074..108490 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
M9O77_RS24990 (108487) | 108487..108717 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
M9O77_RS24995 (108982) | 108982..109482 | + | 501 | WP_000528932.1 | HEPN family nuclease | - |
M9O77_RS25000 (109495) | 109495..110268 | + | 774 | WP_000905949.1 | hypothetical protein | - |
M9O77_RS25005 (110435) | 110435..111568 | + | 1134 | WP_000545984.1 | DUF3800 domain-containing protein | - |
M9O77_RS25010 (111602) | 111602..112114 | - | 513 | WP_000151784.1 | hypothetical protein | - |
M9O77_RS25015 (112682) | 112682..112900 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
M9O77_RS25020 (112902) | 112902..113207 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
M9O77_RS25025 (113208) | 113208..113990 | + | 783 | WP_072644413.1 | site-specific integrase | - |
M9O77_RS25030 (114742) | 114742..115497 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
M9O77_RS25035 (116085) | 116085..117251 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | qnrS1 / tet(A) / sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..170336 | 170336 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T246111 WP_001159868.1 NZ_CP097717:112902-113207 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|