Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 108074..108717 | Replicon | plasmid pMS1718-1 |
| Accession | NZ_CP097717 | ||
| Organism | Escherichia coli strain MS1718 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | M9O77_RS24985 | Protein ID | WP_001034046.1 |
| Coordinates | 108074..108490 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | M9O77_RS24990 | Protein ID | WP_001261278.1 |
| Coordinates | 108487..108717 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O77_RS24970 (103211) | 103211..103627 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| M9O77_RS24975 (103624) | 103624..103854 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M9O77_RS24980 (104235) | 104235..108029 | + | 3795 | WP_001144731.1 | hypothetical protein | - |
| M9O77_RS24985 (108074) | 108074..108490 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M9O77_RS24990 (108487) | 108487..108717 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M9O77_RS24995 (108982) | 108982..109482 | + | 501 | WP_000528932.1 | HEPN family nuclease | - |
| M9O77_RS25000 (109495) | 109495..110268 | + | 774 | WP_000905949.1 | hypothetical protein | - |
| M9O77_RS25005 (110435) | 110435..111568 | + | 1134 | WP_000545984.1 | DUF3800 domain-containing protein | - |
| M9O77_RS25010 (111602) | 111602..112114 | - | 513 | WP_000151784.1 | hypothetical protein | - |
| M9O77_RS25015 (112682) | 112682..112900 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| M9O77_RS25020 (112902) | 112902..113207 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrS1 / tet(A) / sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..170336 | 170336 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T246110 WP_001034046.1 NZ_CP097717:c108490-108074 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |