Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 108074..108717 Replicon plasmid pMS1718-1
Accession NZ_CP097717
Organism Escherichia coli strain MS1718

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag M9O77_RS24985 Protein ID WP_001034046.1
Coordinates 108074..108490 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag M9O77_RS24990 Protein ID WP_001261278.1
Coordinates 108487..108717 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O77_RS24970 (103211) 103211..103627 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
M9O77_RS24975 (103624) 103624..103854 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
M9O77_RS24980 (104235) 104235..108029 + 3795 WP_001144731.1 hypothetical protein -
M9O77_RS24985 (108074) 108074..108490 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
M9O77_RS24990 (108487) 108487..108717 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M9O77_RS24995 (108982) 108982..109482 + 501 WP_000528932.1 HEPN family nuclease -
M9O77_RS25000 (109495) 109495..110268 + 774 WP_000905949.1 hypothetical protein -
M9O77_RS25005 (110435) 110435..111568 + 1134 WP_000545984.1 DUF3800 domain-containing protein -
M9O77_RS25010 (111602) 111602..112114 - 513 WP_000151784.1 hypothetical protein -
M9O77_RS25015 (112682) 112682..112900 + 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
M9O77_RS25020 (112902) 112902..113207 + 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrS1 / tet(A) / sitABCD vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..170336 170336


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T246110 WP_001034046.1 NZ_CP097717:c108490-108074 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT246110 WP_001261278.1 NZ_CP097717:c108717-108487 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References