Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 103211..103854 Replicon plasmid pMS1718-1
Accession NZ_CP097717
Organism Escherichia coli strain MS1718

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag M9O77_RS24970 Protein ID WP_001034044.1
Coordinates 103211..103627 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag M9O77_RS24975 Protein ID WP_001261286.1
Coordinates 103624..103854 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O77_RS24955 (99613) 99613..100310 + 698 WP_223155668.1 IS1-like element IS1A family transposase -
M9O77_RS24960 (100564) 100564..101586 - 1023 WP_000361402.1 helicase UvrD -
M9O77_RS24965 (101571) 101571..103136 - 1566 WP_001128474.1 AAA family ATPase -
M9O77_RS24970 (103211) 103211..103627 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
M9O77_RS24975 (103624) 103624..103854 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M9O77_RS24980 (104235) 104235..108029 + 3795 WP_001144731.1 hypothetical protein -
M9O77_RS24985 (108074) 108074..108490 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
M9O77_RS24990 (108487) 108487..108717 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrS1 / tet(A) / sitABCD vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..170336 170336
- flank IS/Tn - - 99807..100310 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T246109 WP_001034044.1 NZ_CP097717:c103627-103211 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT246109 WP_001261286.1 NZ_CP097717:c103854-103624 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References