Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 103211..103854 | Replicon | plasmid pMS1718-1 |
Accession | NZ_CP097717 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | M9O77_RS24970 | Protein ID | WP_001034044.1 |
Coordinates | 103211..103627 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | M9O77_RS24975 | Protein ID | WP_001261286.1 |
Coordinates | 103624..103854 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS24955 (99613) | 99613..100310 | + | 698 | WP_223155668.1 | IS1-like element IS1A family transposase | - |
M9O77_RS24960 (100564) | 100564..101586 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
M9O77_RS24965 (101571) | 101571..103136 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
M9O77_RS24970 (103211) | 103211..103627 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M9O77_RS24975 (103624) | 103624..103854 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M9O77_RS24980 (104235) | 104235..108029 | + | 3795 | WP_001144731.1 | hypothetical protein | - |
M9O77_RS24985 (108074) | 108074..108490 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
M9O77_RS24990 (108487) | 108487..108717 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | qnrS1 / tet(A) / sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..170336 | 170336 | |
- | flank | IS/Tn | - | - | 99807..100310 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T246109 WP_001034044.1 NZ_CP097717:c103627-103211 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |