Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4510704..4511299 | Replicon | chromosome |
Accession | NZ_CP097716 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | M9O77_RS21560 | Protein ID | WP_000239581.1 |
Coordinates | 4510704..4511054 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | M9O77_RS21565 | Protein ID | WP_001223213.1 |
Coordinates | 4511048..4511299 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS21540 (4506158) | 4506158..4507180 | - | 1023 | WP_167821197.1 | ABC transporter permease | - |
M9O77_RS21545 (4507194) | 4507194..4508696 | - | 1503 | WP_022646474.1 | sugar ABC transporter ATP-binding protein | - |
M9O77_RS21550 (4508829) | 4508829..4509785 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
M9O77_RS21555 (4510095) | 4510095..4510625 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
M9O77_RS21560 (4510704) | 4510704..4511054 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
M9O77_RS21565 (4511048) | 4511048..4511299 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
M9O77_RS21570 (4511511) | 4511511..4511852 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
M9O77_RS21575 (4511855) | 4511855..4515634 | - | 3780 | WP_022646473.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T246107 WP_000239581.1 NZ_CP097716:c4511054-4510704 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|