Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4209047..4209597 Replicon chromosome
Accession NZ_CP097716
Organism Escherichia coli strain MS1718

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag M9O77_RS20110 Protein ID WP_001160966.1
Coordinates 4209047..4209361 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag M9O77_RS20115 Protein ID WP_000125568.1
Coordinates 4209364..4209597 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O77_RS20085 (4204722) 4204722..4206008 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
M9O77_RS20090 (4206008) 4206008..4206997 + 990 WP_000241224.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
M9O77_RS20095 (4206994) 4206994..4207815 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
M9O77_RS20100 (4207818) 4207818..4208195 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
M9O77_RS20105 (4208202) 4208202..4209050 + 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
M9O77_RS20110 (4209047) 4209047..4209361 - 315 WP_001160966.1 CcdB family protein Toxin
M9O77_RS20115 (4209364) 4209364..4209597 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
M9O77_RS20120 (4209683) 4209683..4210162 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
M9O77_RS20125 (4210354) 4210354..4212216 - 1863 WP_022645165.1 glutathione-regulated potassium-efflux system protein KefC -
M9O77_RS20130 (4212209) 4212209..4212739 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
M9O77_RS20135 (4212847) 4212847..4214178 - 1332 WP_001183201.1 MFS transporter -
M9O77_RS20140 (4214236) 4214236..4214523 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T246101 WP_001160966.1 NZ_CP097716:c4209361-4209047 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT246101 WP_000125568.1 NZ_CP097716:c4209597-4209364 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References