Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3919502..3920336 | Replicon | chromosome |
Accession | NZ_CP097716 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | M9O77_RS18795 | Protein ID | WP_079399123.1 |
Coordinates | 3919502..3919879 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | M9O77_RS18800 | Protein ID | WP_129541717.1 |
Coordinates | 3919968..3920336 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS18765 (3915248) | 3915248..3915406 | + | 159 | WP_000550450.1 | hypothetical protein | - |
M9O77_RS18770 (3915473) | 3915473..3915625 | - | 153 | WP_000788776.1 | hypothetical protein | - |
M9O77_RS18775 (3916443) | 3916443..3917762 | + | 1320 | WP_000144688.1 | site-specific integrase | - |
M9O77_RS18780 (3917855) | 3917855..3918703 | - | 849 | WP_134888717.1 | DUF4942 domain-containing protein | - |
M9O77_RS18785 (3918800) | 3918800..3918997 | - | 198 | WP_000772024.1 | DUF957 domain-containing protein | - |
M9O77_RS18790 (3919017) | 3919017..3919505 | - | 489 | WP_032215286.1 | DUF5983 family protein | - |
M9O77_RS18795 (3919502) | 3919502..3919879 | - | 378 | WP_079399123.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
M9O77_RS18800 (3919968) | 3919968..3920336 | - | 369 | WP_129541717.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M9O77_RS18805 (3920415) | 3920415..3920636 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
M9O77_RS18810 (3920699) | 3920699..3921175 | - | 477 | WP_001186773.1 | RadC family protein | - |
M9O77_RS18815 (3921191) | 3921191..3921676 | - | 486 | WP_134888779.1 | antirestriction protein | - |
M9O77_RS18820 (3921731) | 3921731..3922549 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
M9O77_RS18825 (3922649) | 3922649..3922882 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
M9O77_RS18830 (3922961) | 3922961..3923416 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14158.21 Da Isoelectric Point: 7.8523
>T246098 WP_079399123.1 NZ_CP097716:c3919879-3919502 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKR
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.55 Da Isoelectric Point: 6.4652
>AT246098 WP_129541717.1 NZ_CP097716:c3920336-3919968 [Escherichia coli]
VSDTLPGTILPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFALLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTLPGTILPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFALLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|