Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3718446..3719064 | Replicon | chromosome |
Accession | NZ_CP097716 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M9O77_RS17820 | Protein ID | WP_001291435.1 |
Coordinates | 3718846..3719064 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M9O77_RS17815 | Protein ID | WP_000344800.1 |
Coordinates | 3718446..3718820 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS17805 (3713535) | 3713535..3714728 | + | 1194 | WP_167821183.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M9O77_RS17810 (3714751) | 3714751..3717900 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
M9O77_RS17815 (3718446) | 3718446..3718820 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M9O77_RS17820 (3718846) | 3718846..3719064 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M9O77_RS17825 (3719236) | 3719236..3719787 | + | 552 | WP_000536391.1 | maltose O-acetyltransferase | - |
M9O77_RS17830 (3719903) | 3719903..3720373 | + | 471 | WP_022645280.1 | YlaC family protein | - |
M9O77_RS17835 (3720537) | 3720537..3722087 | + | 1551 | WP_012602175.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M9O77_RS17840 (3722128) | 3722128..3722481 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M9O77_RS17850 (3722860) | 3722860..3723171 | + | 312 | WP_000409911.1 | MGMT family protein | - |
M9O77_RS17855 (3723202) | 3723202..3723774 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246097 WP_001291435.1 NZ_CP097716:3718846-3719064 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT246097 WP_000344800.1 NZ_CP097716:3718446-3718820 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |