Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3001160..3001944 | Replicon | chromosome |
Accession | NZ_CP097716 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | M9O77_RS14450 | Protein ID | WP_000613626.1 |
Coordinates | 3001450..3001944 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | M9O77_RS14445 | Protein ID | WP_139352217.1 |
Coordinates | 3001160..3001453 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS14435 (2996309) | 2996309..2997268 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
M9O77_RS14440 (2997841) | 2997841..3001026 | + | 3186 | WP_077516769.1 | ribonuclease E | - |
M9O77_RS14445 (3001160) | 3001160..3001453 | + | 294 | WP_139352217.1 | DUF1778 domain-containing protein | Antitoxin |
M9O77_RS14450 (3001450) | 3001450..3001944 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
M9O77_RS14455 (3002039) | 3002039..3002992 | - | 954 | WP_001212763.1 | flagellar hook-associated protein FlgL | - |
M9O77_RS14460 (3003004) | 3003004..3004647 | - | 1644 | WP_077516765.1 | flagellar hook-associated protein FlgK | - |
M9O77_RS14465 (3004713) | 3004713..3005654 | - | 942 | WP_012311956.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
M9O77_RS14470 (3005654) | 3005654..3006751 | - | 1098 | WP_000589300.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T246094 WP_000613626.1 NZ_CP097716:3001450-3001944 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|