Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2597849..2598487 | Replicon | chromosome |
Accession | NZ_CP097716 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | M9O77_RS12435 | Protein ID | WP_000813794.1 |
Coordinates | 2598311..2598487 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M9O77_RS12430 | Protein ID | WP_001270286.1 |
Coordinates | 2597849..2598265 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS12410 (2593001) | 2593001..2593942 | - | 942 | WP_088129997.1 | ABC transporter permease | - |
M9O77_RS12415 (2593943) | 2593943..2594956 | - | 1014 | WP_022645666.1 | ABC transporter ATP-binding protein | - |
M9O77_RS12420 (2594974) | 2594974..2596119 | - | 1146 | WP_000047466.1 | ABC transporter substrate-binding protein | - |
M9O77_RS12425 (2596364) | 2596364..2597770 | - | 1407 | WP_022645665.1 | PLP-dependent aminotransferase family protein | - |
M9O77_RS12430 (2597849) | 2597849..2598265 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M9O77_RS12435 (2598311) | 2598311..2598487 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M9O77_RS12440 (2598709) | 2598709..2598939 | + | 231 | WP_000491567.1 | DUF2554 family protein | - |
M9O77_RS12445 (2599031) | 2599031..2600992 | - | 1962 | WP_023909195.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M9O77_RS12450 (2601065) | 2601065..2601601 | - | 537 | WP_000429148.1 | DNA-binding transcriptional regulator SutR | - |
M9O77_RS12455 (2601693) | 2601693..2602865 | + | 1173 | WP_022645663.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T246093 WP_000813794.1 NZ_CP097716:c2598487-2598311 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT246093 WP_001270286.1 NZ_CP097716:c2598265-2597849 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|