Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1156198..1156781 | Replicon | chromosome |
Accession | NZ_CP097716 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V0SV58 |
Locus tag | M9O77_RS05510 | Protein ID | WP_000254750.1 |
Coordinates | 1156446..1156781 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | M9O77_RS05505 | Protein ID | WP_000581937.1 |
Coordinates | 1156198..1156446 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS05495 (1152537) | 1152537..1153838 | + | 1302 | WP_077516534.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
M9O77_RS05500 (1153886) | 1153886..1156120 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
M9O77_RS05505 (1156198) | 1156198..1156446 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
M9O77_RS05510 (1156446) | 1156446..1156781 | + | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
M9O77_RS05515 (1156853) | 1156853..1157644 | + | 792 | WP_001071641.1 | nucleoside triphosphate pyrophosphohydrolase | - |
M9O77_RS05520 (1157872) | 1157872..1159509 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
M9O77_RS05525 (1159596) | 1159596..1160894 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T246087 WP_000254750.1 NZ_CP097716:1156446-1156781 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|