Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1005313..1005967 | Replicon | chromosome |
| Accession | NZ_CP097716 | ||
| Organism | Escherichia coli strain MS1718 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | M9O77_RS04830 | Protein ID | WP_000244781.1 |
| Coordinates | 1005560..1005967 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | M9O77_RS04825 | Protein ID | WP_000354046.1 |
| Coordinates | 1005313..1005579 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O77_RS04800 (1000604) | 1000604..1001353 | + | 750 | WP_209319277.1 | transporter | - |
| M9O77_RS04805 (1001401) | 1001401..1002834 | - | 1434 | WP_136698981.1 | 6-phospho-beta-glucosidase BglA | - |
| M9O77_RS04810 (1002879) | 1002879..1003190 | + | 312 | WP_077516667.1 | N(4)-acetylcytidine aminohydrolase | - |
| M9O77_RS04815 (1003354) | 1003354..1004013 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
| M9O77_RS04820 (1004090) | 1004090..1005070 | - | 981 | WP_077516665.1 | tRNA-modifying protein YgfZ | - |
| M9O77_RS04825 (1005313) | 1005313..1005579 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| M9O77_RS04830 (1005560) | 1005560..1005967 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| M9O77_RS04835 (1006007) | 1006007..1006528 | - | 522 | WP_032303736.1 | flavodoxin FldB | - |
| M9O77_RS04840 (1006640) | 1006640..1007536 | + | 897 | WP_000806650.1 | site-specific tyrosine recombinase XerD | - |
| M9O77_RS04845 (1007561) | 1007561..1008271 | + | 711 | WP_077516663.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M9O77_RS04850 (1008277) | 1008277..1010010 | + | 1734 | WP_077516661.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T246086 WP_000244781.1 NZ_CP097716:1005560-1005967 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|