Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 167621..168233 | Replicon | chromosome |
Accession | NZ_CP097716 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | M9O77_RS00735 | Protein ID | WP_000833473.1 |
Coordinates | 167621..167806 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0A1AGA0 |
Locus tag | M9O77_RS00740 | Protein ID | WP_022646255.1 |
Coordinates | 167823..168233 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS00720 (163087) | 163087..164382 | + | 1296 | WP_000985736.1 | Fic family protein | - |
M9O77_RS00725 (164490) | 164490..166028 | + | 1539 | WP_000183976.1 | aldehyde dehydrogenase AldB | - |
M9O77_RS00730 (166069) | 166069..167148 | - | 1080 | WP_000061477.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
M9O77_RS00735 (167621) | 167621..167806 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
M9O77_RS00740 (167823) | 167823..168233 | + | 411 | WP_022646255.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
M9O77_RS00745 (168354) | 168354..170324 | - | 1971 | WP_077517025.1 | glycoside hydrolase family 127 protein | - |
M9O77_RS00750 (170335) | 170335..171735 | - | 1401 | WP_167821214.1 | MFS transporter | - |
M9O77_RS00755 (171961) | 171961..172776 | + | 816 | WP_000891820.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T246083 WP_000833473.1 NZ_CP097716:167621-167806 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15214.08 Da Isoelectric Point: 4.4482
>AT246083 WP_022646255.1 NZ_CP097716:167823-168233 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALAAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALAAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9YXE2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1AGA0 |