Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 36477..36999 Replicon plasmid pMS1718-4
Accession NZ_CP097715
Organism Escherichia coli strain MS1737

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag M9O76_RS25640 Protein ID WP_000220560.1
Coordinates 36477..36758 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag M9O76_RS25645 Protein ID WP_000121743.1
Coordinates 36748..36999 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O76_RS25595 (M9O76_25590) 31486..31977 - 492 WP_000872475.1 transcription termination/antitermination NusG family protein -
M9O76_RS25600 (M9O76_25595) 32338..33495 - 1158 WP_000538023.1 DNA distortion polypeptide 2 -
M9O76_RS25605 (M9O76_25600) 33498..34043 - 546 WP_038976855.1 DNA distortion polypeptide 1 -
M9O76_RS25610 (M9O76_25605) 34370..34642 - 273 WP_000160399.1 hypothetical protein -
M9O76_RS25615 (M9O76_25610) 34655..34804 - 150 WP_000003880.1 hypothetical protein -
M9O76_RS25620 (M9O76_25615) 35091..35420 - 330 WP_000866648.1 hypothetical protein -
M9O76_RS25625 (M9O76_25620) 35513..35728 - 216 WP_001180116.1 hypothetical protein -
M9O76_RS25630 (M9O76_25625) 35718..35963 - 246 WP_000356546.1 hypothetical protein -
M9O76_RS25635 (M9O76_25630) 36008..36331 - 324 WP_001181903.1 hypothetical protein -
M9O76_RS25640 (M9O76_25635) 36477..36758 - 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9O76_RS25645 (M9O76_25640) 36748..36999 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
M9O76_RS25650 (M9O76_25645) 38233..39069 + 837 WP_001050931.1 RepB family plasmid replication initiator protein -
M9O76_RS25655 (M9O76_25650) 39109..39555 + 447 WP_001074386.1 hypothetical protein -
M9O76_RS25660 (M9O76_25655) 39692..40045 + 354 WP_000876434.1 DNA distortion polypeptide 3 -
M9O76_RS25665 (M9O76_25660) 40105..41073 - 969 WP_077249520.1 IS5-like element IS903B family transposase -
M9O76_RS25670 (M9O76_25665) 41075..41368 - 294 WP_015060510.1 hypothetical protein -
M9O76_RS25675 (M9O76_25670) 41384..41614 - 231 WP_000051064.1 plasmid partition protein ParG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / aph(3')-Ia - 1..42571 42571
- flank IS/Tn - - 40105..41028 923


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T246082 WP_000220560.1 NZ_CP097715:c36758-36477 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT246082 WP_000121743.1 NZ_CP097715:c36999-36748 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References