Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 116710..117257 Replicon plasmid pMS1718-2
Accession NZ_CP097713
Organism Escherichia coli strain MS1737

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag M9O76_RS24840 Protein ID WP_001384452.1
Coordinates 116710..116988 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag M9O76_RS24845 Protein ID WP_000079941.1
Coordinates 116988..117257 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O76_RS24805 (111790) 111790..112032 + 243 WP_000844627.1 transposase -
M9O76_RS24810 (112064) 112064..112714 - 651 WP_000164043.1 tetracycline resistance transcriptional repressor TetR(A) -
M9O76_RS24815 (112820) 112820..114019 + 1200 WP_000804064.1 tetracycline efflux MFS transporter Tet(A) -
M9O76_RS24820 (114051) 114051..114911 - 861 WP_000493383.1 EamA family transporter -
M9O76_RS24825 (114920) 114920..115465 - 546 Protein_129 helix-turn-helix domain-containing protein -
M9O76_RS24830 (115460) 115460..115585 + 126 Protein_130 MerR family transcriptional regulator -
M9O76_RS24835 (115822) 115822..116670 - 849 WP_001057996.1 3'-5' exonuclease -
M9O76_RS24840 (116710) 116710..116988 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
M9O76_RS24845 (116988) 116988..117257 - 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
M9O76_RS24850 (117312) 117312..117470 - 159 WP_000841008.1 hypothetical protein -
M9O76_RS24855 (118166) 118166..119197 - 1032 WP_000907875.1 plasmid replication initiator RepA -
M9O76_RS24860 (120155) 120155..120433 + 279 WP_219065241.1 ash family protein -
M9O76_RS24865 (120351) 120351..120638 + 288 WP_000074849.1 conjugal transfer protein TraA -
M9O76_RS24870 (121080) 121080..121613 + 534 WP_001303319.1 transcription termination/antitermination NusG family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / aac(3)-VIa / qacE / sul1 / tet(A) - 1..122563 122563


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T246081 WP_001384452.1 NZ_CP097713:c116988-116710 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT246081 WP_000079941.1 NZ_CP097713:c117257-116988 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References