Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 118697..119340 | Replicon | plasmid pMS1718-1 |
| Accession | NZ_CP097712 | ||
| Organism | Escherichia coli strain MS1737 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | M9O76_RS23890 | Protein ID | WP_001034044.1 |
| Coordinates | 118924..119340 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | M9O76_RS23885 | Protein ID | WP_001261286.1 |
| Coordinates | 118697..118927 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O76_RS23870 (113834) | 113834..114064 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M9O76_RS23875 (114061) | 114061..114477 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| M9O76_RS23880 (114522) | 114522..118316 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
| M9O76_RS23885 (118697) | 118697..118927 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M9O76_RS23890 (118924) | 118924..119340 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M9O76_RS23895 (119415) | 119415..120980 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| M9O76_RS23900 (120965) | 120965..121987 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| M9O76_RS23910 (123294) | 123294..124208 | + | 915 | WP_000949004.1 | iron/manganese ABC transporter substrate-binding protein SitA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iucA / iucB / iucC / iucD / iutA / iroB / iroC / iroD / iroE / iroN | 1..188685 | 188685 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T246076 WP_001034044.1 NZ_CP097712:118924-119340 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |