Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 113834..114477 Replicon plasmid pMS1718-1
Accession NZ_CP097712
Organism Escherichia coli strain MS1737

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag M9O76_RS23875 Protein ID WP_001034046.1
Coordinates 114061..114477 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag M9O76_RS23870 Protein ID WP_001261278.1
Coordinates 113834..114064 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O76_RS23850 (110505) 110505..111236 + 732 WP_011402755.1 replication initiation protein -
M9O76_RS23855 (111916) 111916..112722 - 807 WP_000016968.1 site-specific integrase -
M9O76_RS23860 (112723) 112723..113028 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
M9O76_RS23865 (113030) 113030..113248 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
M9O76_RS23870 (113834) 113834..114064 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M9O76_RS23875 (114061) 114061..114477 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
M9O76_RS23880 (114522) 114522..118316 - 3795 WP_001144732.1 hypothetical protein -
M9O76_RS23885 (118697) 118697..118927 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
M9O76_RS23890 (118924) 118924..119340 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iucA / iucB / iucC / iucD / iutA / iroB / iroC / iroD / iroE / iroN 1..188685 188685


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T246075 WP_001034046.1 NZ_CP097712:114061-114477 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT246075 WP_001261278.1 NZ_CP097712:113834-114064 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References