Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 112723..113248 | Replicon | plasmid pMS1718-1 |
Accession | NZ_CP097712 | ||
Organism | Escherichia coli strain MS1737 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | M9O76_RS23860 | Protein ID | WP_001159871.1 |
Coordinates | 112723..113028 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H9TJP1 |
Locus tag | M9O76_RS23865 | Protein ID | WP_000813630.1 |
Coordinates | 113030..113248 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O76_RS23845 (108679) | 108679..109884 | - | 1206 | WP_001442122.1 | AAA family ATPase | - |
M9O76_RS23850 (110505) | 110505..111236 | + | 732 | WP_011402755.1 | replication initiation protein | - |
M9O76_RS23855 (111916) | 111916..112722 | - | 807 | WP_000016968.1 | site-specific integrase | - |
M9O76_RS23860 (112723) | 112723..113028 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
M9O76_RS23865 (113030) | 113030..113248 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
M9O76_RS23870 (113834) | 113834..114064 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
M9O76_RS23875 (114061) | 114061..114477 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | vat / iucA / iucB / iucC / iucD / iutA / iroB / iroC / iroD / iroE / iroN | 1..188685 | 188685 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T246074 WP_001159871.1 NZ_CP097712:c113028-112723 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CEF5 |