Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 68387..69012 | Replicon | plasmid pMS1718-1 |
Accession | NZ_CP097712 | ||
Organism | Escherichia coli strain MS1737 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M9O76_RS23595 | Protein ID | WP_000911333.1 |
Coordinates | 68614..69012 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | M9O76_RS23590 | Protein ID | WP_000450520.1 |
Coordinates | 68387..68614 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O76_RS23590 (68387) | 68387..68614 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
M9O76_RS23595 (68614) | 68614..69012 | + | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
M9O76_RS23600 (69021) | 69021..71174 | - | 2154 | WP_000009379.1 | type IV conjugative transfer system coupling protein TraD | - |
M9O76_RS23605 (71427) | 71427..72158 | - | 732 | WP_000850416.1 | conjugal transfer complement resistance protein TraT | - |
M9O76_RS23610 (72172) | 72172..72681 | - | 510 | WP_000628105.1 | conjugal transfer entry exclusion protein TraS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | vat / iucA / iucB / iucC / iucD / iutA / iroB / iroC / iroD / iroE / iroN | 1..188685 | 188685 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T246070 WP_000911333.1 NZ_CP097712:68614-69012 [Escherichia coli]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|