Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 55839..56374 Replicon plasmid pMS1718-1
Accession NZ_CP097712
Organism Escherichia coli strain MS1737

Toxin (Protein)


Gene name relE Uniprot ID V0VJJ7
Locus tag M9O76_RS23520 Protein ID WP_000222760.1
Coordinates 55839..56126 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag M9O76_RS23525 Protein ID WP_001132900.1
Coordinates 56123..56374 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O76_RS23490 (51422) 51422..52643 - 1222 Protein_61 ISL3 family transposase -
M9O76_RS23495 (52743) 52743..53107 + 365 Protein_62 IS1 family transposase -
M9O76_RS23500 (53162) 53162..53944 - 783 WP_001442137.1 IS21-like element IS100kyp family helper ATPase IstB -
M9O76_RS23505 (53941) 53941..54963 - 1023 WP_000255956.1 IS21-like element IS100 family transposase -
M9O76_RS23510 (55052) 55052..55399 + 348 Protein_65 IS1-like element IS1A family transposase -
M9O76_RS23515 (55415) 55415..55735 - 321 Protein_66 serine acetyltransferase -
M9O76_RS23520 (55839) 55839..56126 - 288 WP_000222760.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9O76_RS23525 (56123) 56123..56374 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M9O76_RS23530 (57337) 57337..58194 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
M9O76_RS23535 (58187) 58187..58669 - 483 WP_001273588.1 hypothetical protein -
M9O76_RS23540 (58662) 58662..58709 - 48 WP_229471593.1 hypothetical protein -
M9O76_RS23545 (58700) 58700..58951 + 252 WP_223195197.1 replication protein RepA -
M9O76_RS23550 (58968) 58968..59225 - 258 WP_000083845.1 replication regulatory protein RepA -
M9O76_RS23555 (59509) 59509..59658 - 150 WP_001312851.1 Hok/Gef family protein -
- (59702) 59702..59763 + 62 NuclAT_1 - -
- (59702) 59702..59763 + 62 NuclAT_1 - -
- (59702) 59702..59763 + 62 NuclAT_1 - -
- (59702) 59702..59763 + 62 NuclAT_1 - -
M9O76_RS23560 (60019) 60019..60093 - 75 Protein_75 endonuclease -
M9O76_RS23565 (60339) 60339..60551 - 213 WP_001299730.1 ANR family transcriptional regulator -
M9O76_RS23570 (60687) 60687..61247 - 561 WP_000139315.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iucA / iucB / iucC / iucD / iutA / iroB / iroC / iroD / iroE / iroN 1..188685 188685


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11105.15 Da        Isoelectric Point: 10.5832

>T246068 WP_000222760.1 NZ_CP097712:c56126-55839 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT246068 WP_001132900.1 NZ_CP097712:c56374-56123 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0VJJ7

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References