Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3877557..3878107 Replicon chromosome
Accession NZ_CP097711
Organism Escherichia coli strain MS1737

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag M9O76_RS18755 Protein ID WP_001160966.1
Coordinates 3877557..3877871 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag M9O76_RS18760 Protein ID WP_000125566.1
Coordinates 3877874..3878107 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O76_RS18730 (3873232) 3873232..3874518 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
M9O76_RS18735 (3874518) 3874518..3875507 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
M9O76_RS18740 (3875504) 3875504..3876325 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
M9O76_RS18745 (3876328) 3876328..3876705 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
M9O76_RS18750 (3876712) 3876712..3877560 + 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
M9O76_RS18755 (3877557) 3877557..3877871 - 315 WP_001160966.1 CcdB family protein Toxin
M9O76_RS18760 (3877874) 3877874..3878107 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
M9O76_RS18765 (3878193) 3878193..3878672 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
M9O76_RS18770 (3878864) 3878864..3880726 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
M9O76_RS18775 (3880719) 3880719..3881114 - 396 Protein_3677 glutathione-regulated potassium-efflux system oxidoreductase KefF -
M9O76_RS18780 (3881300) 3881300..3881461 + 162 WP_001571575.1 hypothetical protein -
M9O76_RS18785 (3881465) 3881465..3882097 - 633 WP_000460689.1 hypothetical protein -
M9O76_RS18790 (3882212) 3882212..3882610 - 399 WP_001281696.1 Mor transcription activator family protein -
M9O76_RS18795 (3882582) 3882582..3883031 - 450 WP_001299262.1 regulatory protein GemA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3875504..3918751 43247


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T246064 WP_001160966.1 NZ_CP097711:c3877871-3877557 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT246064 WP_000125566.1 NZ_CP097711:c3878107-3877874 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References