Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 995515..996169 | Replicon | chromosome |
Accession | NZ_CP097711 | ||
Organism | Escherichia coli strain MS1737 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | M9O76_RS04930 | Protein ID | WP_000244781.1 |
Coordinates | 995762..996169 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | M9O76_RS04925 | Protein ID | WP_000354046.1 |
Coordinates | 995515..995781 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O76_RS04905 (991603) | 991603..993036 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
M9O76_RS04910 (993081) | 993081..993392 | + | 312 | WP_001182948.1 | N(4)-acetylcytidine aminohydrolase | - |
M9O76_RS04915 (993556) | 993556..994215 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
M9O76_RS04920 (994292) | 994292..995272 | - | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
M9O76_RS04925 (995515) | 995515..995781 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
M9O76_RS04930 (995762) | 995762..996169 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
M9O76_RS04935 (996209) | 996209..996730 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
M9O76_RS04940 (996842) | 996842..997738 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
M9O76_RS04945 (997763) | 997763..998473 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M9O76_RS04950 (998479) | 998479..1000212 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T246054 WP_000244781.1 NZ_CP097711:995762-996169 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|