Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2505198..2506240 | Replicon | chromosome |
Accession | NZ_CP097710 | ||
Organism | Pseudomonas aeruginosa strain PA-2 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | M8342_RS12005 | Protein ID | WP_003153636.1 |
Coordinates | 2505665..2506240 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | M8342_RS12000 | Protein ID | WP_003050245.1 |
Coordinates | 2505198..2505668 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8342_RS11965 (M8342_11960) | 2500590..2502008 | - | 1419 | WP_023100422.1 | TIGR03752 family integrating conjugative element protein | - |
M8342_RS11970 (M8342_11965) | 2501998..2502909 | - | 912 | WP_023100423.1 | TIGR03749 family integrating conjugative element protein | - |
M8342_RS11975 (M8342_11970) | 2502906..2503598 | - | 693 | WP_023100424.1 | TIGR03746 family integrating conjugative element protein | - |
M8342_RS11980 (M8342_11975) | 2503595..2503993 | - | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
M8342_RS11985 (M8342_11980) | 2504005..2504364 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
M8342_RS11990 (M8342_11985) | 2504381..2504614 | - | 234 | WP_003090170.1 | TIGR03758 family integrating conjugative element protein | - |
M8342_RS11995 (M8342_11990) | 2504611..2504994 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
M8342_RS12000 (M8342_11995) | 2505198..2505668 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
M8342_RS12005 (M8342_12000) | 2505665..2506240 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
M8342_RS12010 (M8342_12005) | 2506258..2507172 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
M8342_RS12015 (M8342_12010) | 2507169..2507639 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
M8342_RS12020 (M8342_12015) | 2507636..2508136 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
M8342_RS12025 (M8342_12020) | 2508136..2509038 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
M8342_RS12030 (M8342_12025) | 2509077..2509802 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2415305..2552355 | 137050 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T246048 WP_003153636.1 NZ_CP097710:2505665-2506240 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT246048 WP_003050245.1 NZ_CP097710:2505198-2505668 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|