Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2504095..2505137 | Replicon | chromosome |
Accession | NZ_CP097709 | ||
Organism | Pseudomonas aeruginosa strain PA-1 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | M8341_RS11995 | Protein ID | WP_003153636.1 |
Coordinates | 2504562..2505137 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | M8341_RS11990 | Protein ID | WP_003050245.1 |
Coordinates | 2504095..2504565 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8341_RS11955 (M8341_11950) | 2499487..2500905 | - | 1419 | WP_023100422.1 | TIGR03752 family integrating conjugative element protein | - |
M8341_RS11960 (M8341_11955) | 2500895..2501806 | - | 912 | WP_023100423.1 | TIGR03749 family integrating conjugative element protein | - |
M8341_RS11965 (M8341_11960) | 2501803..2502495 | - | 693 | WP_023100424.1 | TIGR03746 family integrating conjugative element protein | - |
M8341_RS11970 (M8341_11965) | 2502492..2502890 | - | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
M8341_RS11975 (M8341_11970) | 2502902..2503261 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
M8341_RS11980 (M8341_11975) | 2503278..2503511 | - | 234 | WP_003090170.1 | TIGR03758 family integrating conjugative element protein | - |
M8341_RS11985 (M8341_11980) | 2503508..2503891 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
M8341_RS11990 (M8341_11985) | 2504095..2504565 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
M8341_RS11995 (M8341_11990) | 2504562..2505137 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
M8341_RS12000 (M8341_11995) | 2505155..2506069 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
M8341_RS12005 (M8341_12000) | 2506066..2506536 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
M8341_RS12010 (M8341_12005) | 2506533..2507033 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
M8341_RS12015 (M8341_12010) | 2507033..2507935 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
M8341_RS12020 (M8341_12015) | 2507974..2508699 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2414202..2551252 | 137050 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T246041 WP_003153636.1 NZ_CP097709:2504562-2505137 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT246041 WP_003050245.1 NZ_CP097709:2504095-2504565 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|