Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 128178..128821 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP097707 | ||
| Organism | Klebsiella pneumoniae strain IR12197_1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | M3X87_RS29225 | Protein ID | WP_001044770.1 |
| Coordinates | 128178..128594 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | M3X87_RS29230 | Protein ID | WP_001261282.1 |
| Coordinates | 128591..128821 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X87_RS29205 (124281) | 124281..124553 | - | 273 | Protein_151 | transposase | - |
| M3X87_RS29215 (125535) | 125535..126557 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| M3X87_RS29220 (126542) | 126542..128104 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| M3X87_RS29225 (128178) | 128178..128594 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3X87_RS29230 (128591) | 128591..128821 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M3X87_RS29235 (128778) | 128778..129239 | + | 462 | WP_014343465.1 | hypothetical protein | - |
| M3X87_RS29240 (129400) | 129400..130343 | + | 944 | Protein_158 | hypothetical protein | - |
| M3X87_RS29245 (130380) | 130380..130772 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| M3X87_RS29250 (130830) | 130830..131351 | + | 522 | WP_013214008.1 | hypothetical protein | - |
| M3X87_RS29255 (131397) | 131397..131600 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| M3X87_RS29260 (131630) | 131630..132634 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| M3X87_RS29265 (132818) | 132818..133597 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-65 / rmtB / blaKPC-2 | - | 1..159393 | 159393 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T246037 WP_001044770.1 NZ_CP097707:c128594-128178 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |