Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 98127..98652 Replicon plasmid unnamed1
Accession NZ_CP097704
Organism Klebsiella pneumoniae strain IR12197_1

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag M3X87_RS27315 Protein ID WP_013023785.1
Coordinates 98347..98652 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag M3X87_RS27310 Protein ID WP_001568025.1
Coordinates 98127..98345 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X87_RS27290 (M3X87_27290) 93283..94062 + 780 WP_013023780.1 hypothetical protein -
M3X87_RS27295 (M3X87_27295) 94338..95861 + 1524 WP_017899887.1 hypothetical protein -
M3X87_RS27300 (M3X87_27300) 95895..97022 + 1128 WP_013023782.1 DUF4238 domain-containing protein -
M3X87_RS27305 (M3X87_27305) 97019..97309 + 291 WP_013023783.1 hypothetical protein -
M3X87_RS27310 (M3X87_27310) 98127..98345 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M3X87_RS27315 (M3X87_27315) 98347..98652 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
M3X87_RS27320 (M3X87_27320) 98821..99216 + 396 WP_017899885.1 hypothetical protein -
M3X87_RS27325 (M3X87_27325) 99243..99557 + 315 WP_053389906.1 hypothetical protein -
M3X87_RS27330 (M3X87_27330) 99568..100584 + 1017 WP_017899884.1 hypothetical protein -
M3X87_RS27335 (M3X87_27335) 100782..101576 + 795 WP_004197635.1 site-specific integrase -
M3X87_RS27340 (M3X87_27340) 102064..102366 - 303 WP_004197636.1 hypothetical protein -
M3X87_RS27345 (M3X87_27345) 102363..102989 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(3)-IId / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 - 1..108673 108673


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T246030 WP_013023785.1 NZ_CP097704:98347-98652 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT246030 WP_001568025.1 NZ_CP097704:98127-98345 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References