Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4149637..4150256 Replicon chromosome
Accession NZ_CP097703
Organism Klebsiella pneumoniae strain IR12197_1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M3X87_RS20630 Protein ID WP_002892050.1
Coordinates 4150038..4150256 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M3X87_RS20625 Protein ID WP_002892066.1
Coordinates 4149637..4150011 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X87_RS20615 (M3X87_20615) 4144789..4145982 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M3X87_RS20620 (M3X87_20620) 4146005..4149151 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
M3X87_RS20625 (M3X87_20625) 4149637..4150011 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M3X87_RS20630 (M3X87_20630) 4150038..4150256 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M3X87_RS20635 (M3X87_20635) 4150415..4150981 + 567 WP_002892030.1 maltose O-acetyltransferase -
M3X87_RS20640 (M3X87_20640) 4150953..4151093 - 141 WP_004147370.1 hypothetical protein -
M3X87_RS20645 (M3X87_20645) 4151114..4151584 + 471 WP_002892026.1 YlaC family protein -
M3X87_RS20650 (M3X87_20650) 4151559..4153010 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M3X87_RS20655 (M3X87_20655) 4153111..4153809 + 699 WP_002892021.1 GNAT family protein -
M3X87_RS20660 (M3X87_20660) 4153806..4153946 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M3X87_RS20665 (M3X87_20665) 4153946..4154209 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T246027 WP_002892050.1 NZ_CP097703:4150038-4150256 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT246027 WP_002892066.1 NZ_CP097703:4149637-4150011 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References