Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 8496..9021 Replicon plasmid unnamed1
Accession NZ_CP097698
Organism Klebsiella pneumoniae strain IR12183_1

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag M3X92_RS26185 Protein ID WP_013023785.1
Coordinates 8716..9021 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag M3X92_RS26180 Protein ID WP_001568025.1
Coordinates 8496..8714 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X92_RS26155 (M3X92_26155) 4622..5644 - 1023 WP_000361404.1 helicase UvrD -
M3X92_RS26160 (M3X92_26160) 5629..7191 - 1563 WP_004206609.1 AAA family ATPase -
M3X92_RS26165 (M3X92_26165) 7265..7681 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
M3X92_RS26170 (M3X92_26170) 7678..7908 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
M3X92_RS26175 (M3X92_26175) 7865..8326 + 462 WP_160866775.1 hypothetical protein -
M3X92_RS26180 (M3X92_26180) 8496..8714 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M3X92_RS26185 (M3X92_26185) 8716..9021 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
M3X92_RS26190 (M3X92_26190) 9190..9585 + 396 WP_017899885.1 hypothetical protein -
M3X92_RS26195 (M3X92_26195) 9612..9926 + 315 WP_053389906.1 hypothetical protein -
M3X92_RS26200 (M3X92_26200) 9937..10953 + 1017 WP_017899884.1 hypothetical protein -
M3X92_RS26205 (M3X92_26205) 11151..11945 + 795 WP_004197635.1 site-specific integrase -
M3X92_RS26210 (M3X92_26210) 12425..12727 - 303 WP_004197636.1 hypothetical protein -
M3X92_RS26215 (M3X92_26215) 12724..13350 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / mph(A) / dfrA25 - 1..110851 110851
- flank IS/Tn - - 3669..4046 377


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T246016 WP_013023785.1 NZ_CP097698:8716-9021 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT246016 WP_001568025.1 NZ_CP097698:8496-8714 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References