Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4056955..4057574 Replicon chromosome
Accession NZ_CP097697
Organism Klebsiella pneumoniae strain IR12183_1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M3X92_RS20145 Protein ID WP_002892050.1
Coordinates 4057356..4057574 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M3X92_RS20140 Protein ID WP_002892066.1
Coordinates 4056955..4057329 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X92_RS20130 (M3X92_20130) 4052107..4053300 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M3X92_RS20135 (M3X92_20135) 4053323..4056469 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
M3X92_RS20140 (M3X92_20140) 4056955..4057329 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M3X92_RS20145 (M3X92_20145) 4057356..4057574 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M3X92_RS20150 (M3X92_20150) 4057733..4058299 + 567 WP_002892030.1 maltose O-acetyltransferase -
M3X92_RS20155 (M3X92_20155) 4058271..4058411 - 141 WP_004147370.1 hypothetical protein -
M3X92_RS20160 (M3X92_20160) 4058432..4058902 + 471 WP_002892026.1 YlaC family protein -
M3X92_RS20165 (M3X92_20165) 4058877..4060328 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M3X92_RS20170 (M3X92_20170) 4060429..4061127 + 699 WP_002892021.1 GNAT family protein -
M3X92_RS20175 (M3X92_20175) 4061124..4061264 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M3X92_RS20180 (M3X92_20180) 4061264..4061527 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T246010 WP_002892050.1 NZ_CP097697:4057356-4057574 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT246010 WP_002892066.1 NZ_CP097697:4056955-4057329 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References