Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 98149..98792 Replicon plasmid unnamed1
Accession NZ_CP097695
Organism Klebsiella pneumoniae strain IR12182_1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M3X85_RS27650 Protein ID WP_001044770.1
Coordinates 98149..98565 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag M3X85_RS27655 Protein ID WP_001261282.1
Coordinates 98562..98792 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X85_RS27630 (94252) 94252..94524 - 273 Protein_134 transposase -
M3X85_RS27640 (95506) 95506..96528 - 1023 WP_000361404.1 helicase UvrD -
M3X85_RS27645 (96513) 96513..98075 - 1563 WP_004206609.1 AAA family ATPase -
M3X85_RS27650 (98149) 98149..98565 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M3X85_RS27655 (98562) 98562..98792 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M3X85_RS27660 (98749) 98749..99210 + 462 WP_160866775.1 hypothetical protein -
M3X85_RS27665 (99380) 99380..99598 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
M3X85_RS27670 (99600) 99600..99905 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
M3X85_RS27675 (100074) 100074..100469 + 396 WP_017899885.1 hypothetical protein -
M3X85_RS27680 (100496) 100496..100810 + 315 WP_053389906.1 hypothetical protein -
M3X85_RS27685 (100821) 100821..101837 + 1017 WP_017899884.1 hypothetical protein -
M3X85_RS27690 (102035) 102035..102829 + 795 WP_004197635.1 site-specific integrase -
M3X85_RS27695 (103293) 103293..103595 - 303 WP_004197636.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / rmtB / blaTEM-1B - 1..131777 131777


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T245998 WP_001044770.1 NZ_CP097695:c98565-98149 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT245998 WP_001261282.1 NZ_CP097695:c98792-98562 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References