Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 113979..114622 Replicon plasmid unnamed1
Accession NZ_CP097693
Organism Klebsiella pneumoniae strain IR12094_1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M3T51_RS27925 Protein ID WP_001044770.1
Coordinates 113979..114395 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag M3T51_RS27930 Protein ID WP_001261282.1
Coordinates 114392..114622 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3T51_RS27905 (110082) 110082..110354 - 273 Protein_155 transposase -
M3T51_RS27915 (111336) 111336..112358 - 1023 WP_000361404.1 helicase UvrD -
M3T51_RS27920 (112343) 112343..113905 - 1563 WP_004206609.1 AAA family ATPase -
M3T51_RS27925 (113979) 113979..114395 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M3T51_RS27930 (114392) 114392..114622 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M3T51_RS27935 (114579) 114579..115040 + 462 WP_014343465.1 hypothetical protein -
M3T51_RS27940 (115201) 115201..116145 + 945 WP_011977810.1 hypothetical protein -
M3T51_RS27945 (116182) 116182..116574 + 393 WP_011977811.1 hypothetical protein -
M3T51_RS27950 (116632) 116632..117153 + 522 WP_013214008.1 hypothetical protein -
M3T51_RS27955 (117199) 117199..117402 + 204 WP_011977813.1 hypothetical protein -
M3T51_RS27960 (117432) 117432..118436 + 1005 WP_011977814.1 hypothetical protein -
M3T51_RS27965 (118620) 118620..119399 + 780 WP_013214009.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid catA2 / blaCTX-M-65 / fosA3 / rmtB / blaTEM-1B / blaSHV-12 / blaKPC-2 - 1..130677 130677


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T245976 WP_001044770.1 NZ_CP097693:c114395-113979 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT245976 WP_001261282.1 NZ_CP097693:c114622-114392 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References