Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4219673..4220292 Replicon chromosome
Accession NZ_CP097692
Organism Klebsiella pneumoniae strain IR12094_1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M3T51_RS21015 Protein ID WP_002892050.1
Coordinates 4220074..4220292 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M3T51_RS21010 Protein ID WP_002892066.1
Coordinates 4219673..4220047 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3T51_RS21000 (M3T51_21000) 4214825..4216018 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M3T51_RS21005 (M3T51_21005) 4216041..4219187 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
M3T51_RS21010 (M3T51_21010) 4219673..4220047 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M3T51_RS21015 (M3T51_21015) 4220074..4220292 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M3T51_RS21020 (M3T51_21020) 4220451..4221017 + 567 WP_002892030.1 maltose O-acetyltransferase -
M3T51_RS21025 (M3T51_21025) 4220989..4221129 - 141 WP_004147370.1 hypothetical protein -
M3T51_RS21030 (M3T51_21030) 4221150..4221620 + 471 WP_002892026.1 YlaC family protein -
M3T51_RS21035 (M3T51_21035) 4221595..4223046 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M3T51_RS21040 (M3T51_21040) 4223147..4223845 + 699 WP_002892021.1 GNAT family protein -
M3T51_RS21045 (M3T51_21045) 4223842..4223982 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M3T51_RS21050 (M3T51_21050) 4223982..4224245 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245965 WP_002892050.1 NZ_CP097692:4220074-4220292 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245965 WP_002892066.1 NZ_CP097692:4219673-4220047 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References