Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 183333..184084 | Replicon | plasmid unnamed2 |
Accession | NZ_CP097690 | ||
Organism | Klebsiella pneumoniae strain IR12079_1 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | H6U1U8 |
Locus tag | M3X89_RS29280 | Protein ID | WP_014386536.1 |
Coordinates | 183333..183815 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | M3X89_RS29285 | Protein ID | WP_004902250.1 |
Coordinates | 183806..184084 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3X89_RS29260 (M3X89_29260) | 179732..180379 | - | 648 | WP_014386537.1 | EcsC family protein | - |
M3X89_RS29265 (M3X89_29265) | 180406..181161 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
M3X89_RS29270 (M3X89_29270) | 181262..181654 | - | 393 | WP_032442757.1 | hypothetical protein | - |
M3X89_RS29275 (M3X89_29275) | 181759..182298 | - | 540 | WP_004902239.1 | hypothetical protein | - |
M3X89_RS29280 (M3X89_29280) | 183333..183815 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
M3X89_RS29285 (M3X89_29285) | 183806..184084 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
M3X89_RS29290 (M3X89_29290) | 184203..184415 | - | 213 | WP_004902255.1 | hypothetical protein | - |
M3X89_RS29295 (M3X89_29295) | 184523..184864 | - | 342 | WP_004902257.1 | hypothetical protein | - |
M3X89_RS29300 (M3X89_29300) | 185694..186152 | - | 459 | WP_014386535.1 | hypothetical protein | - |
M3X89_RS29305 (M3X89_29305) | 186805..187260 | - | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
M3X89_RS29310 (M3X89_29310) | 187332..187697 | + | 366 | WP_001294656.1 | mercuric ion transporter MerT | - |
M3X89_RS29315 (M3X89_29315) | 187713..187988 | + | 276 | WP_000732275.1 | mercury resistance system periplasmic binding protein MerP | - |
M3X89_RS29320 (M3X89_29320) | 188016..188441 | + | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul1 / qacE / ARR-3 / catB3 / blaOXA-1 / aac(6')-Ib-cr | iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..230866 | 230866 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T245949 WP_014386536.1 NZ_CP097690:c183815-183333 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MBI1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A071LPN3 |