Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 139882..140552 Replicon plasmid unnamed2
Accession NZ_CP097690
Organism Klebsiella pneumoniae strain IR12079_1

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag M3X89_RS29060 Protein ID WP_004213072.1
Coordinates 139882..140325 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag M3X89_RS29065 Protein ID WP_004213073.1
Coordinates 140322..140552 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X89_RS29025 (M3X89_29025) 135290..135565 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
M3X89_RS29030 (M3X89_29030) 135628..136119 + 492 WP_011251327.1 DM13 domain-containing protein -
M3X89_RS29035 (M3X89_29035) 136168..137088 + 921 WP_004213934.1 DUF1471 domain-containing protein -
M3X89_RS29040 (M3X89_29040) 137179..137582 + 404 Protein_134 GAF domain-containing protein -
M3X89_RS29045 (M3X89_29045) 138100..138738 - 639 Protein_135 mucoid phenotype regulator RmpA2 -
M3X89_RS29050 (M3X89_29050) 139155..139459 + 305 Protein_136 transposase -
M3X89_RS29055 (M3X89_29055) 139482..139733 - 252 WP_186987481.1 hypothetical protein -
M3X89_RS29060 (M3X89_29060) 139882..140325 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
M3X89_RS29065 (M3X89_29065) 140322..140552 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M3X89_RS29070 (M3X89_29070) 141160..142293 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
M3X89_RS29075 (M3X89_29075) 142309..142602 + 294 WP_004213076.1 hypothetical protein -
M3X89_RS29080 (M3X89_29080) 142592..142798 - 207 WP_004213077.1 hypothetical protein -
M3X89_RS29085 (M3X89_29085) 143150..143440 + 291 WP_004213078.1 hypothetical protein -
M3X89_RS29090 (M3X89_29090) 143430..144329 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul1 / qacE / ARR-3 / catB3 / blaOXA-1 / aac(6')-Ib-cr iucA / iucB / iucC / iucD / iutA / rmpA2 1..230866 230866


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T245948 WP_004213072.1 NZ_CP097690:c140325-139882 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT245948 WP_004213073.1 NZ_CP097690:c140552-140322 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References