Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4991977..4992493 | Replicon | chromosome |
Accession | NZ_CP097688 | ||
Organism | Klebsiella pneumoniae strain IR12079_1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | M3X89_RS24985 | Protein ID | WP_002886902.1 |
Coordinates | 4991977..4992261 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M3X89_RS24990 | Protein ID | WP_002886901.1 |
Coordinates | 4992251..4992493 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3X89_RS24960 (M3X89_24960) | 4987462..4987725 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
M3X89_RS24965 (M3X89_24965) | 4987855..4988028 | + | 174 | WP_002886906.1 | hypothetical protein | - |
M3X89_RS24970 (M3X89_24970) | 4988031..4988774 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M3X89_RS24975 (M3X89_24975) | 4989131..4991268 | + | 2138 | Protein_4907 | anaerobic ribonucleoside-triphosphate reductase | - |
M3X89_RS24980 (M3X89_24980) | 4991509..4991973 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M3X89_RS24985 (M3X89_24985) | 4991977..4992261 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M3X89_RS24990 (M3X89_24990) | 4992251..4992493 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M3X89_RS24995 (M3X89_24995) | 4992571..4994481 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
M3X89_RS25000 (M3X89_25000) | 4994504..4995658 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
M3X89_RS25005 (M3X89_25005) | 4995724..4996464 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T245942 WP_002886902.1 NZ_CP097688:c4992261-4991977 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |