Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4275086..4275705 | Replicon | chromosome |
Accession | NZ_CP097688 | ||
Organism | Klebsiella pneumoniae strain IR12079_1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | M3X89_RS21540 | Protein ID | WP_002892050.1 |
Coordinates | 4275487..4275705 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | M3X89_RS21535 | Protein ID | WP_002892066.1 |
Coordinates | 4275086..4275460 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3X89_RS21525 (M3X89_21525) | 4270238..4271431 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M3X89_RS21530 (M3X89_21530) | 4271454..4274600 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
M3X89_RS21535 (M3X89_21535) | 4275086..4275460 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
M3X89_RS21540 (M3X89_21540) | 4275487..4275705 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
M3X89_RS21545 (M3X89_21545) | 4275864..4276430 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
M3X89_RS21550 (M3X89_21550) | 4276402..4276542 | - | 141 | WP_004147370.1 | hypothetical protein | - |
M3X89_RS21555 (M3X89_21555) | 4276563..4277033 | + | 471 | WP_002892026.1 | YlaC family protein | - |
M3X89_RS21560 (M3X89_21560) | 4277008..4278459 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
M3X89_RS21565 (M3X89_21565) | 4278560..4279258 | + | 699 | WP_002892021.1 | GNAT family protein | - |
M3X89_RS21570 (M3X89_21570) | 4279255..4279395 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
M3X89_RS21575 (M3X89_21575) | 4279395..4279658 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T245940 WP_002892050.1 NZ_CP097688:4275487-4275705 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT245940 WP_002892066.1 NZ_CP097688:4275086-4275460 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |