Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 50096..50739 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP097686 | ||
| Organism | Klebsiella pneumoniae strain IR12073_1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | M3X91_RS27945 | Protein ID | WP_001044770.1 |
| Coordinates | 50096..50512 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | M3X91_RS27950 | Protein ID | WP_001261282.1 |
| Coordinates | 50509..50739 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X91_RS27925 (46199) | 46199..46471 | - | 273 | Protein_55 | transposase | - |
| M3X91_RS27935 (47453) | 47453..48475 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| M3X91_RS27940 (48460) | 48460..50022 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| M3X91_RS27945 (50096) | 50096..50512 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3X91_RS27950 (50509) | 50509..50739 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M3X91_RS27955 (50696) | 50696..51157 | + | 462 | WP_014343465.1 | hypothetical protein | - |
| M3X91_RS27960 (51318) | 51318..52262 | + | 945 | WP_011977810.1 | hypothetical protein | - |
| M3X91_RS27965 (52299) | 52299..52691 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| M3X91_RS27970 (52749) | 52749..53270 | + | 522 | WP_094960442.1 | hypothetical protein | - |
| M3X91_RS27975 (53316) | 53316..53519 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| M3X91_RS27980 (53549) | 53549..54553 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| M3X91_RS27985 (54737) | 54737..55516 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 / catA2 / blaCTX-M-65 | - | 1..153836 | 153836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T245923 WP_001044770.1 NZ_CP097686:c50512-50096 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |