Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 1562..2151 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097684 | ||
| Organism | Klebsiella pneumoniae strain IR12073_1 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | M3X91_RS26980 | Protein ID | WP_250203242.1 |
| Coordinates | 1828..2151 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2X1PRM1 |
| Locus tag | M3X91_RS26975 | Protein ID | WP_000093040.1 |
| Coordinates | 1562..1840 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X91_RS26960 (M3X91_26960) | 135..380 | + | 246 | WP_032440458.1 | hypothetical protein | - |
| M3X91_RS26965 (M3X91_26965) | 654..1025 | + | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
| M3X91_RS26970 (M3X91_26970) | 1022..1387 | + | 366 | WP_072354022.1 | TonB family protein | - |
| M3X91_RS26975 (M3X91_26975) | 1562..1840 | + | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| M3X91_RS26980 (M3X91_26980) | 1828..2151 | + | 324 | WP_250203242.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M3X91_RS26985 (M3X91_26985) | 2304..2732 | + | 429 | WP_001140599.1 | hypothetical protein | - |
| M3X91_RS26990 (M3X91_26990) | 2758..2937 | + | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
| M3X91_RS26995 (M3X91_26995) | 2964..3494 | - | 531 | WP_071177729.1 | hypothetical protein | - |
| M3X91_RS27000 (M3X91_27000) | 3501..4232 | - | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
| M3X91_RS27005 (M3X91_27005) | 4232..6196 | - | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..10832 | 10832 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12191.11 Da Isoelectric Point: 10.3092
>T245922 WP_250203242.1 NZ_CP097684:1828-2151 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGQTASNNR
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGQTASNNR
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|