Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5401074..5401699 | Replicon | chromosome |
| Accession | NZ_CP097683 | ||
| Organism | Klebsiella pneumoniae strain IR12073_1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | M3X91_RS26595 | Protein ID | WP_002882817.1 |
| Coordinates | 5401074..5401457 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | M3X91_RS26600 | Protein ID | WP_004150355.1 |
| Coordinates | 5401457..5401699 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X91_RS26580 (M3X91_26580) | 5398440..5399342 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| M3X91_RS26585 (M3X91_26585) | 5399339..5399974 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M3X91_RS26590 (M3X91_26590) | 5399971..5400900 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| M3X91_RS26595 (M3X91_26595) | 5401074..5401457 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3X91_RS26600 (M3X91_26600) | 5401457..5401699 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| M3X91_RS26605 (M3X91_26605) | 5401904..5402821 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
| M3X91_RS26610 (M3X91_26610) | 5402835..5403776 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| M3X91_RS26615 (M3X91_26615) | 5403821..5404258 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| M3X91_RS26620 (M3X91_26620) | 5404255..5405114 | - | 860 | Protein_5213 | virulence factor BrkB family protein | - |
| M3X91_RS26625 (M3X91_26625) | 5405108..5405707 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T245921 WP_002882817.1 NZ_CP097683:c5401457-5401074 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |