Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4206118..4206737 Replicon chromosome
Accession NZ_CP097683
Organism Klebsiella pneumoniae strain IR12073_1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M3X91_RS20835 Protein ID WP_002892050.1
Coordinates 4206519..4206737 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M3X91_RS20830 Protein ID WP_002892066.1
Coordinates 4206118..4206492 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X91_RS20820 (M3X91_20820) 4201270..4202463 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M3X91_RS20825 (M3X91_20825) 4202486..4205632 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
M3X91_RS20830 (M3X91_20830) 4206118..4206492 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M3X91_RS20835 (M3X91_20835) 4206519..4206737 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M3X91_RS20840 (M3X91_20840) 4206896..4207462 + 567 WP_002892030.1 maltose O-acetyltransferase -
M3X91_RS20845 (M3X91_20845) 4207434..4207574 - 141 WP_004147370.1 hypothetical protein -
M3X91_RS20850 (M3X91_20850) 4207595..4208065 + 471 WP_002892026.1 YlaC family protein -
M3X91_RS20855 (M3X91_20855) 4208040..4209491 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M3X91_RS20860 (M3X91_20860) 4209592..4210290 + 699 WP_002892021.1 GNAT family protein -
M3X91_RS20865 (M3X91_20865) 4210287..4210427 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M3X91_RS20870 (M3X91_20870) 4210427..4210690 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245917 WP_002892050.1 NZ_CP097683:4206519-4206737 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245917 WP_002892066.1 NZ_CP097683:4206118-4206492 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References