Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 770829..771460 | Replicon | chromosome |
| Accession | NZ_CP097683 | ||
| Organism | Klebsiella pneumoniae strain IR12073_1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1Q8YTV3 |
| Locus tag | M3X91_RS03875 | Protein ID | WP_012542177.1 |
| Coordinates | 770829..771005 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M3X91_RS03880 | Protein ID | WP_101856539.1 |
| Coordinates | 771053..771460 (+) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X91_RS03855 (M3X91_03855) | 766698..767042 | + | 345 | WP_064147746.1 | antiterminator Q family protein | - |
| M3X91_RS03860 (M3X91_03860) | 767037..768263 | - | 1227 | WP_064147745.1 | hypothetical protein | - |
| M3X91_RS03865 (M3X91_03865) | 768253..769398 | - | 1146 | WP_023328101.1 | nucleoid-associated protein | - |
| M3X91_RS03870 (M3X91_03870) | 769638..770606 | + | 969 | WP_013362812.1 | IS5-like element IS903B family transposase | - |
| M3X91_RS03875 (M3X91_03875) | 770829..771005 | + | 177 | WP_012542177.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M3X91_RS03880 (M3X91_03880) | 771053..771460 | + | 408 | WP_101856539.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M3X91_RS03885 (M3X91_03885) | 772197..772466 | + | 270 | WP_032439907.1 | phage holin | - |
| M3X91_RS03890 (M3X91_03890) | 772444..772941 | + | 498 | WP_032439908.1 | lysozyme | - |
| M3X91_RS03895 (M3X91_03895) | 772938..773288 | + | 351 | WP_017898986.1 | hypothetical protein | - |
| M3X91_RS03900 (M3X91_03900) | 774369..774557 | + | 189 | WP_071888095.1 | hypothetical protein | - |
| M3X91_RS03905 (M3X91_03905) | 774662..774886 | + | 225 | WP_223177722.1 | DNA gyrase subunit B | - |
| M3X91_RS03910 (M3X91_03910) | 775040..775402 | + | 363 | WP_017898990.1 | HNH endonuclease signature motif containing protein | - |
| M3X91_RS03915 (M3X91_03915) | 775354..775671 | + | 318 | WP_014228902.1 | hypothetical protein | - |
| M3X91_RS03920 (M3X91_03920) | 775668..776099 | + | 432 | WP_077259664.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 744945..857321 | 112376 | |
| - | flank | IS/Tn | - | - | 769683..770606 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6632.83 Da Isoelectric Point: 11.0174
>T245910 WP_012542177.1 NZ_CP097683:770829-771005 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14992.02 Da Isoelectric Point: 4.4277
>AT245910 WP_101856539.1 NZ_CP097683:771053-771460 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARMINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIIVH
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARMINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIIVH
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|