Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 263889..264799 Replicon plasmid unnamed1
Accession NZ_CP097680
Organism Klebsiella pneumoniae strain IR12061_1

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag M3X88_RS28355 Protein ID WP_004026354.1
Coordinates 264329..264799 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag M3X88_RS28350 Protein ID WP_004026357.1
Coordinates 263889..264332 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X88_RS28320 (258907) 258907..259428 + 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -
M3X88_RS28325 (259425) 259425..260378 + 954 Protein_295 ferric citrate uptake sigma factor regulator FecR -
M3X88_RS28330 (260465) 260465..262591 + 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
M3X88_RS28335 (262666) 262666..262791 + 126 Protein_297 Fe3+-citrate ABC transporter substrate-binding protein -
M3X88_RS28340 (262966) 262966..263187 + 222 WP_004213643.1 DUF2188 domain-containing protein -
M3X88_RS28345 (263285) 263285..263788 + 504 Protein_299 DUF4113 domain-containing protein -
M3X88_RS28350 (263889) 263889..264332 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
M3X88_RS28355 (264329) 264329..264799 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
M3X88_RS28360 (264948) 264948..265645 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
M3X88_RS28365 (267031) 267031..267681 - 651 WP_068893702.1 DUF1173 family protein -
M3X88_RS28370 (267714) 267714..267980 - 267 WP_223175074.1 DUF1173 family protein -
M3X88_RS28375 (268158) 268158..268652 + 495 WP_004212794.1 thermonuclease family protein -
M3X88_RS28380 (268989) 268989..269387 + 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / sul1 / qacE / aadA5 / dfrA17 / aac(3)-IId rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB 1..274502 274502


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T245902 WP_004026354.1 NZ_CP097680:264329-264799 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT245902 WP_004026357.1 NZ_CP097680:263889-264332 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References