Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 73240..73765 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097680 | ||
| Organism | Klebsiella pneumoniae strain IR12061_1 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | M3X88_RS27230 | Protein ID | WP_001159871.1 |
| Coordinates | 73460..73765 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | M3X88_RS27225 | Protein ID | WP_000813634.1 |
| Coordinates | 73240..73458 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X88_RS27205 (68813) | 68813..69244 | + | 432 | WP_023302802.1 | silver-binding protein SilE | - |
| M3X88_RS27210 (69388) | 69388..69738 | + | 351 | WP_004213569.1 | DUF305 domain-containing protein | - |
| M3X88_RS27215 (70125) | 70125..71033 | - | 909 | WP_023302803.1 | HNH endonuclease | - |
| M3X88_RS27220 (71670) | 71670..72644 | + | 975 | WP_004213565.1 | sensor domain-containing diguanylate cyclase | - |
| M3X88_RS27225 (73240) | 73240..73458 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| M3X88_RS27230 (73460) | 73460..73765 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| M3X88_RS27235 (73766) | 73766..74575 | + | 810 | WP_000016979.1 | site-specific integrase | - |
| M3X88_RS27240 (74713) | 74713..74988 | - | 276 | WP_000239529.1 | hypothetical protein | - |
| M3X88_RS27245 (74982) | 74982..75626 | - | 645 | WP_000633911.1 | AAA family ATPase | - |
| M3X88_RS27250 (75855) | 75855..76826 | + | 972 | WP_001103694.1 | plasmid segregation protein ParM | - |
| M3X88_RS27255 (76831) | 76831..77223 | + | 393 | WP_000340835.1 | plasmid partitioning/stability family protein | - |
| M3X88_RS27260 (77228) | 77228..77479 | - | 252 | Protein_82 | DUF4113 domain-containing protein | - |
| M3X88_RS27265 (77541) | 77541..78338 | - | 798 | WP_000544830.1 | IS21-like element IS21 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA5 / dfrA17 / aac(3)-IId | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB | 1..274502 | 274502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T245898 WP_001159871.1 NZ_CP097680:73460-73765 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3TCJ | |
| PDB | 2H3A | |
| PDB | 2ADN | |
| PDB | 2ADL | |
| PDB | 3HPW | |
| PDB | 2H3C | |
| PDB | 3G7Z | |
| AlphaFold DB | A0A829CQY2 |