Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4168159..4168778 Replicon chromosome
Accession NZ_CP097679
Organism Klebsiella pneumoniae strain IR12061_1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M3X88_RS20750 Protein ID WP_002892050.1
Coordinates 4168560..4168778 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M3X88_RS20745 Protein ID WP_002892066.1
Coordinates 4168159..4168533 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X88_RS20735 (M3X88_20735) 4163311..4164504 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M3X88_RS20740 (M3X88_20740) 4164527..4167673 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
M3X88_RS20745 (M3X88_20745) 4168159..4168533 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M3X88_RS20750 (M3X88_20750) 4168560..4168778 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M3X88_RS20755 (M3X88_20755) 4168937..4169503 + 567 WP_002892030.1 maltose O-acetyltransferase -
M3X88_RS20760 (M3X88_20760) 4169475..4169615 - 141 WP_004147370.1 hypothetical protein -
M3X88_RS20765 (M3X88_20765) 4169636..4170106 + 471 WP_002892026.1 YlaC family protein -
M3X88_RS20770 (M3X88_20770) 4170081..4171532 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M3X88_RS20775 (M3X88_20775) 4171633..4172331 + 699 WP_002892021.1 GNAT family protein -
M3X88_RS20780 (M3X88_20780) 4172328..4172468 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M3X88_RS20785 (M3X88_20785) 4172468..4172731 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245893 WP_002892050.1 NZ_CP097679:4168560-4168778 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245893 WP_002892066.1 NZ_CP097679:4168159-4168533 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References