Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 152668..153404 | Replicon | plasmid unnamed3 |
Accession | NZ_CP097678 | ||
Organism | Klebsiella pneumoniae strain IR12024_1 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | M3T48_RS29165 | Protein ID | WP_003026803.1 |
Coordinates | 152668..153150 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | M3T48_RS29170 | Protein ID | WP_003026799.1 |
Coordinates | 153138..153404 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3T48_RS29145 (M3T48_29145) | 148196..149014 | + | 819 | WP_004181718.1 | phospholipase D family protein | - |
M3T48_RS29150 (M3T48_29150) | 149418..149816 | + | 399 | WP_004181717.1 | H-NS family nucleoid-associated regulatory protein | - |
M3T48_RS29155 (M3T48_29155) | 150403..151035 | + | 633 | WP_001567369.1 | hypothetical protein | - |
M3T48_RS29160 (M3T48_29160) | 151064..152467 | - | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
M3T48_RS29165 (M3T48_29165) | 152668..153150 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
M3T48_RS29170 (M3T48_29170) | 153138..153404 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
M3T48_RS29175 (M3T48_29175) | 153649..153966 | - | 318 | WP_224440782.1 | cell envelope integrity protein TolA | - |
M3T48_RS29180 (M3T48_29180) | 154020..155000 | + | 981 | WP_000019445.1 | IS5-like element ISKpn26 family transposase | - |
M3T48_RS29185 (M3T48_29185) | 155146..155688 | - | 543 | Protein_160 | DEAD/DEAH box helicase | - |
M3T48_RS29190 (M3T48_29190) | 155685..156986 | - | 1302 | WP_148719203.1 | ATP-binding protein | - |
M3T48_RS29195 (M3T48_29195) | 157021..157626 | - | 606 | WP_000509966.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..288415 | 288415 | |
- | inside | IScluster/Tn | - | - | 151064..160618 | 9554 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T245882 WP_003026803.1 NZ_CP097678:c153150-152668 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |