Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 152890..153533 Replicon plasmid unnamed2
Accession NZ_CP097677
Organism Klebsiella pneumoniae strain IR12024_1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M3T48_RS28325 Protein ID WP_001044770.1
Coordinates 152890..153306 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag M3T48_RS28330 Protein ID WP_001261282.1
Coordinates 153303..153533 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3T48_RS28305 (149722) 149722..149946 - 225 WP_049090873.1 helix-turn-helix domain-containing protein -
M3T48_RS28310 (150128) 150128..150691 + 564 WP_048981108.1 transcriptional regulator -
M3T48_RS28315 (150899) 150899..151588 + 690 WP_206971191.1 IS6 family transposase -
M3T48_RS28320 (151638) 151638..152816 - 1179 Protein_208 AAA family ATPase -
M3T48_RS28325 (152890) 152890..153306 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M3T48_RS28330 (153303) 153303..153533 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M3T48_RS28335 (153490) 153490..153951 + 462 WP_014343465.1 hypothetical protein -
M3T48_RS28340 (154112) 154112..155056 + 945 WP_011977810.1 hypothetical protein -
M3T48_RS28345 (155093) 155093..155485 + 393 WP_011977811.1 hypothetical protein -
M3T48_RS28350 (155543) 155543..156064 + 522 WP_013214008.1 hypothetical protein -
M3T48_RS28355 (156110) 156110..156313 + 204 WP_011977813.1 hypothetical protein -
M3T48_RS28360 (156343) 156343..157347 + 1005 WP_011977814.1 hypothetical protein -
M3T48_RS28365 (157531) 157531..158310 + 780 WP_013214009.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12 - 1..162611 162611
- flank IS/Tn - - 150848..151588 740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T245881 WP_001044770.1 NZ_CP097677:c153306-152890 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT245881 WP_001261282.1 NZ_CP097677:c153533-153303 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References