Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 19017..19660 | Replicon | plasmid unnamed4 |
Accession | NZ_CP097674 | ||
Organism | Klebsiella pneumoniae strain IR5077_1 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | M3X94_RS29320 | Protein ID | WP_001044770.1 |
Coordinates | 19017..19433 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | M3X94_RS29325 | Protein ID | WP_001261282.1 |
Coordinates | 19430..19660 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3X94_RS29300 (M3X94_29300) | 15120..15392 | - | 273 | Protein_22 | transposase | - |
M3X94_RS29310 (M3X94_29310) | 16374..17396 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
M3X94_RS29315 (M3X94_29315) | 17381..18943 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
M3X94_RS29320 (M3X94_29320) | 19017..19433 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M3X94_RS29325 (M3X94_29325) | 19430..19660 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M3X94_RS29330 (M3X94_29330) | 19617..20078 | + | 462 | WP_014343465.1 | hypothetical protein | - |
M3X94_RS29335 (M3X94_29335) | 20239..21183 | + | 945 | WP_011977810.1 | hypothetical protein | - |
M3X94_RS29340 (M3X94_29340) | 21220..21612 | + | 393 | WP_011977811.1 | hypothetical protein | - |
M3X94_RS29345 (M3X94_29345) | 21670..22191 | + | 522 | WP_013214008.1 | hypothetical protein | - |
M3X94_RS29350 (M3X94_29350) | 22237..22440 | + | 204 | WP_011977813.1 | hypothetical protein | - |
M3X94_RS29355 (M3X94_29355) | 22470..23474 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
M3X94_RS29360 (M3X94_29360) | 23658..24437 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaKPC-2 | - | 1..92812 | 92812 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T245860 WP_001044770.1 NZ_CP097674:c19433-19017 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |