Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 150440..151110 Replicon plasmid unnamed3
Accession NZ_CP097673
Organism Klebsiella pneumoniae strain IR5077_1

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag M3X94_RS28375 Protein ID WP_004213072.1
Coordinates 150667..151110 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag M3X94_RS28370 Protein ID WP_004213073.1
Coordinates 150440..150670 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X94_RS28345 (146663) 146663..147562 - 900 WP_004225022.1 nucleotide-binding protein -
M3X94_RS28350 (147552) 147552..147842 - 291 WP_004213078.1 hypothetical protein -
M3X94_RS28355 (148194) 148194..148400 + 207 WP_004213077.1 hypothetical protein -
M3X94_RS28360 (148390) 148390..148683 - 294 WP_004213076.1 hypothetical protein -
M3X94_RS28365 (148699) 148699..149832 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
M3X94_RS28370 (150440) 150440..150670 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M3X94_RS28375 (150667) 150667..151110 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
M3X94_RS28380 (151259) 151259..151510 + 252 WP_186987481.1 hypothetical protein -
M3X94_RS28385 (151533) 151533..151837 - 305 Protein_173 transposase -
M3X94_RS28390 (152254) 152254..152890 + 637 Protein_174 mucoid phenotype regulator RmpA2 -
M3X94_RS28395 (153408) 153408..153811 - 404 Protein_175 GAF domain-containing protein -
M3X94_RS28400 (153902) 153902..154822 - 921 WP_004213934.1 DUF1471 domain-containing protein -
M3X94_RS28405 (154871) 154871..155362 - 492 WP_011251327.1 DM13 domain-containing protein -
M3X94_RS28410 (155425) 155425..155700 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaSHV-12 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA 1..292919 292919


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T245853 WP_004213072.1 NZ_CP097673:150667-151110 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT245853 WP_004213073.1 NZ_CP097673:150440-150670 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References