Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 13895..14631 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP097673 | ||
| Organism | Klebsiella pneumoniae strain IR5077_1 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J5Q928 |
| Locus tag | M3X94_RS27620 | Protein ID | WP_004098919.1 |
| Coordinates | 14149..14631 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
| Locus tag | M3X94_RS27615 | Protein ID | WP_004213599.1 |
| Coordinates | 13895..14161 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X94_RS27595 (11408) | 11408..12412 | + | 1005 | WP_000427619.1 | IS110-like element IS5075 family transposase | - |
| M3X94_RS27600 (12698) | 12698..13192 | + | 495 | WP_004213594.1 | hypothetical protein | - |
| M3X94_RS27605 (13253) | 13253..13456 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
| M3X94_RS27610 (13470) | 13470..13700 | + | 231 | WP_004213598.1 | hypothetical protein | - |
| M3X94_RS27615 (13895) | 13895..14161 | + | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
| M3X94_RS27620 (14149) | 14149..14631 | + | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
| M3X94_RS27625 (15052) | 15052..16279 | + | 1228 | Protein_19 | IS3 family transposase | - |
| M3X94_RS27630 (16275) | 16275..16670 | - | 396 | Protein_20 | IS3 family transposase | - |
| M3X94_RS27635 (16845) | 16845..17867 | - | 1023 | WP_004214536.1 | porphobilinogen synthase | - |
| M3X94_RS27640 (17864) | 17864..18901 | - | 1038 | WP_226321664.1 | amidohydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaSHV-12 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB | rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA | 1..292919 | 292919 | |
| - | inside | IScluster/Tn | blaSHV-12 | - | 126..16279 | 16153 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T245852 WP_004098919.1 NZ_CP097673:14149-14631 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q928 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D3T1D0 |