Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 192690..193333 Replicon plasmid unnamed5
Accession NZ_CP097668
Organism Klebsiella pneumoniae strain IR1230_1

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag M3X90_RS30260 Protein ID WP_001034044.1
Coordinates 192690..193106 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag M3X90_RS30265 Protein ID WP_001261286.1
Coordinates 193103..193333 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X90_RS30245 (M3X90_30245) 189092..189789 + 698 WP_223155668.1 IS1-like element IS1A family transposase -
M3X90_RS30250 (M3X90_30250) 190043..191065 - 1023 WP_000361402.1 helicase UvrD -
M3X90_RS30255 (M3X90_30255) 191050..192615 - 1566 WP_001128474.1 AAA family ATPase -
M3X90_RS30260 (M3X90_30260) 192690..193106 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
M3X90_RS30265 (M3X90_30265) 193103..193333 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M3X90_RS30270 (M3X90_30270) 193714..197508 + 3795 WP_001144732.1 hypothetical protein -
M3X90_RS30275 (M3X90_30275) 197553..197969 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
M3X90_RS30280 (M3X90_30280) 197966..198196 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(3)-IId / tet(D) / tet(A) / dfrA1 / qacE / sul1 / qnrS1 / blaLAP-2 / sitABCD iucA / iucB / iucC / iucD / iutA 1..200049 200049
- flank IS/Tn - - 189286..189789 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T245837 WP_001034044.1 NZ_CP097668:c193106-192690 [Klebsiella pneumoniae]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT245837 WP_001261286.1 NZ_CP097668:c193333-193103 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References