Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 55300..55943 Replicon plasmid unnamed3
Accession NZ_CP097666
Organism Klebsiella pneumoniae strain IR1230_1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M3X90_RS27690 Protein ID WP_001044770.1
Coordinates 55527..55943 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag M3X90_RS27685 Protein ID WP_001261282.1
Coordinates 55300..55530 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3X90_RS27645 (50497) 50497..50799 + 303 WP_004197636.1 hypothetical protein -
M3X90_RS27650 (51263) 51263..52057 - 795 WP_004197635.1 site-specific integrase -
M3X90_RS27655 (52255) 52255..53271 - 1017 WP_017899884.1 hypothetical protein -
M3X90_RS27660 (53282) 53282..53596 - 315 WP_053389906.1 hypothetical protein -
M3X90_RS27665 (53623) 53623..54018 - 396 WP_017899885.1 hypothetical protein -
M3X90_RS27670 (54187) 54187..54492 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
M3X90_RS27675 (54494) 54494..54712 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
M3X90_RS27680 (54882) 54882..55343 - 462 WP_160866775.1 hypothetical protein -
M3X90_RS27685 (55300) 55300..55530 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M3X90_RS27690 (55527) 55527..55943 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M3X90_RS27695 (56017) 56017..57579 + 1563 WP_004206609.1 AAA family ATPase -
M3X90_RS27700 (57564) 57564..58586 + 1023 WP_000361404.1 helicase UvrD -
M3X90_RS27705 (58842) 58842..59539 + 698 WP_223174630.1 IS1 family transposase -
M3X90_RS27710 (59568) 59568..59840 + 273 Protein_79 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-55 / mph(A) / sul1 / dfrA25 / blaKPC-2 / aac(3)-IId / sul2 / aph(3'')-Ib / aph(6)-Id - 1..147295 147295


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T245827 WP_001044770.1 NZ_CP097666:55527-55943 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT245827 WP_001261282.1 NZ_CP097666:55300-55530 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References